SCOPe 2.08: Domain d3h7ea1: 3h7e A:3-229

Lineage for d3h7ea1 (3h7e A:3-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [102265] (5 PDB entries)

8. Domain d3h7ea1: 3h7e A:3-229 [305460]
   Other proteins in same PDB: d3h7ea2
   automated match to d3rjza_
   complexed with amp
   has additional subdomain(s) that are not in the common domain

Details for d3h7ea1

PDB Entry: 3h7e, 2.4 Å

PDB Description: Crystal Structure of an N-type ATP pyrophosphatase (PF0828) in complex with AMP from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR23

PDB Compounds: (A:) N-type ATP pyrophosphatase superfamily

SCOPe Domain Sequences for d3h7ea1:

Sequence, based on SEQRES records:

>d3h7ea1 c.26.2.1 (A:3-229) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral
giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp
awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag
eggefetfvldmplfkykivvdkakkvwepctssgkliieeahlesk

Sequence, based on observed residues (ATOM records):

>d3h7ea1 c.26.2.1 (A:3-229) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvsenesymyhtinanltdlqaralg
iplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytpa
rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
efetfvldmplfkykivvdkakkvweptssgkliieeahlesk

Timeline for d3h7ea1:

• d3h7ea1 first appeared in SCOPe 2.06
  
• d3h7ea1 appears in SCOPe 2.07