Lineage for d1vdc_2 (1vdc 118-243)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) 
Protein Thioredoxin reductase [51950] (2 species) 
Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [51952] (1 PDB entry) 
Domain d1vdc_2: 1vdc 118-243 [30546]
Details for d1vdc_2
PDB Entry: 1vdc (more details), 2.5 Å
PDB Description: structure of nadph dependent thioredoxin reductase
SCOP Domain Sequences for d1vdc_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vdc_2 c.3.1.5 (118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana)}
rlsfvgsgevlggfwnrgisacavcdgaapifrnkplavigggdsameeanfltkygskv
yiihrrdafraskimqqralsnpkidviwnssvveaygdgerdvlgglkvknvvtgdvsd
lkvsglffai
SCOP Domain Coordinates for d1vdc_2:
Click to download the PDB-style file with coordinates for d1vdc_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vdc_2:
- d1vdc_2 first appeared (with stable ids) in SCOP 1.55
- d1vdc_2 appears in SCOP 1.59
- d1vdc_2 appears in the current release, SCOPe 2.08, called d1vdca2
View in 3D
