SCOPe 2.08: Domain d1vdca2: 1vdc A:118-243

Lineage for d1vdca2 (1vdc A:118-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Thioredoxin reductase [51950] (2 species)
   lacks the "interface" C-terminal alpha+beta domain

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51952] (1 PDB entry)

8. Domain d1vdca2: 1vdc A:118-243 [30546]
   complexed with fad, so4
   missing some secondary structures that made up less than one-third of the common domain

Details for d1vdca2

PDB Entry: 1vdc, 2.5 Å

PDB Description: structure of nadph dependent thioredoxin reductase

PDB Compounds: (A:) nadph dependent thioredoxin reductase

SCOPe Domain Sequences for d1vdca2:

Sequence; same for both SEQRES and ATOM records:

>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rlsfvgsgevlggfwnrgisacavcdgaapifrnkplavigggdsameeanfltkygskv
yiihrrdafraskimqqralsnpkidviwnssvveaygdgerdvlgglkvknvvtgdvsd
lkvsglffai

Timeline for d1vdca2:

• d1vdca2 first appeared (with stable ids) in SCOP 1.55, called d1vdc_2
  
• d1vdca2 appears in SCOPe 2.07