Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.10: Rho GTPase binding domain [310659] (3 proteins) Pfam PF08337 |
Protein Plexin-D1 [310823] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [311090] (1 PDB entry) |
Domain d3h6na_: 3h6n A: [305459] complexed with ars, unx |
PDB Entry: 3h6n (more details), 2 Å
SCOPe Domain Sequences for d3h6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h6na_ d.15.1.10 (A:) Plexin-D1 {Human (Homo sapiens) [TaxId: 9606]} akprnlnvsfqgcgmdslsvramdtdtltqvkekileafcknvpysqwpraedvdlewfa sstqsyilrdlddtsvvedgrkklntlahykipegaslamslid
Timeline for d3h6na_: