Lineage for d3h6na_ (3h6n A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933091Family d.15.1.10: Rho GTPase binding domain [310659] (3 proteins)
    Pfam PF08337
  6. 2933098Protein Plexin-D1 [310823] (1 species)
  7. 2933099Species Human (Homo sapiens) [TaxId:9606] [311090] (1 PDB entry)
  8. 2933100Domain d3h6na_: 3h6n A: [305459]
    complexed with ars, unx

Details for d3h6na_

PDB Entry: 3h6n (more details), 2 Å

PDB Description: crystal structure of the ubiquitin-like domain of plexin d1
PDB Compounds: (A:) Plexin-D1

SCOPe Domain Sequences for d3h6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h6na_ d.15.1.10 (A:) Plexin-D1 {Human (Homo sapiens) [TaxId: 9606]}
akprnlnvsfqgcgmdslsvramdtdtltqvkekileafcknvpysqwpraedvdlewfa
sstqsyilrdlddtsvvedgrkklntlahykipegaslamslid

SCOPe Domain Coordinates for d3h6na_:

Click to download the PDB-style file with coordinates for d3h6na_.
(The format of our PDB-style files is described here.)

Timeline for d3h6na_: