Lineage for d3h5dc_ (3h5d C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445258Species Streptococcus pneumoniae [TaxId:406556] [226690] (3 PDB entries)
  8. 2445265Domain d3h5dc_: 3h5d C: [305453]
    Other proteins in same PDB: d3h5da2
    automated match to d3vfla_
    complexed with co3, mes

Details for d3h5dc_

PDB Entry: 3h5d (more details), 1.99 Å

PDB Description: Dihydrodipicolinate Synthase from Drug-Resistant Streptococcus pneumoniae
PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3h5dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h5dc_ c.1.10.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
syqdlkeckiitafitpfhedgsinfdaipaliehllahhtdgillagttaesptlthde
elelfaavqkvvngrvpliagvgtndtrdsiefvkevaefggfaaglaivpyynkpsqeg
myqhfkaiadasdlpiiiynipgrvvveltpetmlrladhpniigvkectslanmaylie
hkpeefliytgedgdafhamnlgadgvisvashtngdemhemftaiaesdmkkaaaiqrk
fipkvnalfsypspapvkailnymgfeagptrlplvpapeedvkriikvvvdgdyeat

SCOPe Domain Coordinates for d3h5dc_:

Click to download the PDB-style file with coordinates for d3h5dc_.
(The format of our PDB-style files is described here.)

Timeline for d3h5dc_: