Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:406556] [226690] (3 PDB entries) |
Domain d3h5dc_: 3h5d C: [305453] Other proteins in same PDB: d3h5da2 automated match to d3vfla_ complexed with co3, mes |
PDB Entry: 3h5d (more details), 1.99 Å
SCOPe Domain Sequences for d3h5dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h5dc_ c.1.10.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 406556]} syqdlkeckiitafitpfhedgsinfdaipaliehllahhtdgillagttaesptlthde elelfaavqkvvngrvpliagvgtndtrdsiefvkevaefggfaaglaivpyynkpsqeg myqhfkaiadasdlpiiiynipgrvvveltpetmlrladhpniigvkectslanmaylie hkpeefliytgedgdafhamnlgadgvisvashtngdemhemftaiaesdmkkaaaiqrk fipkvnalfsypspapvkailnymgfeagptrlplvpapeedvkriikvvvdgdyeat
Timeline for d3h5dc_:
View in 3D Domains from other chains: (mouse over for more information) d3h5da1, d3h5da2, d3h5db_, d3h5dd_ |