Lineage for d1vdc_1 (1vdc 1-117,244-316)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67382Protein Thioredoxin reductase [51950] (2 species)
  7. 67400Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [51952] (1 PDB entry)
  8. 67401Domain d1vdc_1: 1vdc 1-117,244-316 [30545]

Details for d1vdc_1

PDB Entry: 1vdc (more details), 2.5 Å

PDB Description: structure of nadph dependent thioredoxin reductase

SCOP Domain Sequences for d1vdc_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdc_1 c.3.1.5 (1-117,244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana)}
lethntrlcivgsgpaahtaaiyaaraelkpllfegwmandiapggqlttttdvenfpgf
pegilgveltdkfrkqserfgttiftetvtkvdfsskpfklftdskailadavilaigav
akXghepatkfldggveldsdgyvvtkpgttqtsvpgvfaagdvqdkkyrqaitaagtgc
maaldaehylqei

SCOP Domain Coordinates for d1vdc_1:

Click to download the PDB-style file with coordinates for d1vdc_1.
(The format of our PDB-style files is described here.)

Timeline for d1vdc_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vdc_2