Lineage for d3h4ja1 (3h4j A:28-351)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2222226Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [311292] (1 PDB entry)
  8. 2222227Domain d3h4ja1: 3h4j A:28-351 [305446]
    Other proteins in same PDB: d3h4ja2, d3h4jb2
    automated match to d4ynza_

Details for d3h4ja1

PDB Entry: 3h4j (more details), 2.8 Å

PDB Description: crystal structure of pombe ampk kdaid fragment
PDB Compounds: (A:) SNF1-like protein kinase ssp2

SCOPe Domain Sequences for d3h4ja1:

Sequence, based on SEQRES records: (download)

>d3h4ja1 d.144.1.0 (A:28-351) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
krhigpyiiretlgegsfgkvklathyktqqkvalkfisrqllkksdmhmrvereisylk
llrhphiiklydvittptdivmvieyaggelfdyivekkrmtedegrrffqqiicaieyc
hrhkivhrdlkpenlllddnlnvkiadfglsnimtdgnflktscgspnyaapevingkly
agpevdvwscgivlyvmlvgrlpfddefipnlfkkvnscvyvmpdflspgaqslirrmiv
adpmqritiqeirrdpwfnvnlpdylrpmeevqgsyadsrivsklgeamgfsedyiveal
rsdennevkeaynllhenqviqek

Sequence, based on observed residues (ATOM records): (download)

>d3h4ja1 d.144.1.0 (A:28-351) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
krhigpyiiretlgegsfgkvklathyktqqkvalkfisrqllkksdmhmrvereisylk
llrhphiiklydvittptdivmvieyaggelfdyivekkrmtedegrrffqqiicaieyc
hrhkivhrdlkpenlllddnlnvkiadfglsnimtdgnflktscgspnyaapevingkly
agpevdvwscgivlyvmlvgrlpfddefiyvmpdflspgaqslirrmivadpmqritiqe
irrdpwfnvnlpdylrpmeevqgsyadsrivsklgeamgfsedyivealrsdennevkea
ynllhenqviqek

SCOPe Domain Coordinates for d3h4ja1:

Click to download the PDB-style file with coordinates for d3h4ja1.
(The format of our PDB-style files is described here.)

Timeline for d3h4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h4ja2