SCOPe 2.06: Domain d3gqbd3: 3gqb D:362-464

Lineage for d3gqbd3 (3gqb D:362-464)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins)

6. Protein V1 ATP synthase B subunit, C-terminal domain [310710] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310944] (2 PDB entries)

8. Domain d3gqbd3: 3gqb D:362-464 [305439]
   Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba3, d3gqba4, d3gqbb1, d3gqbb2, d3gqbc1, d3gqbc2, d3gqbc3, d3gqbc4, d3gqbd1, d3gqbd2

Details for d3gqbd3

PDB Entry: 3gqb, 2.8 Å

PDB Description: crystal structure of the a3b3 complex from v-atpase

PDB Compounds: (D:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3gqbd3:

Sequence; same for both SEQRES and ATOM records:

>d3gqbd3 a.69.1.2 (D:362-464) V1 ATP synthase B subunit, C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
mnngvgkgktredhkqvsdqlysayangvdirklvaiigedaltendrrylqfadaferf
finqgqqnrsieeslqiawallsmlpqgelkriskdhigkyyg

Timeline for d3gqbd3:

• d3gqbd3 is new in SCOPe 2.06-stable
  
• d3gqbd3 appears in SCOPe 2.07
  
• d3gqbd3 appears in the current release, SCOPe 2.08