| Class b: All beta proteins [48724] (180 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
| Family b.49.1.2: N-terminal domain of A and B subunits of V1 ATP synthase [310615] (2 proteins) |
| Protein V1 ATP synthase B subunit, domain 1 [310702] (2 species) |
| Species Thermus thermophilus HB8 [TaxId:300852] [310926] (2 PDB entries) |
| Domain d3gqbd1: 3gqb D:5-78 [305437] Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba3, d3gqba4, d3gqbb2, d3gqbb3, d3gqbc1, d3gqbc2, d3gqbc3, d3gqbc4, d3gqbd2, d3gqbd3 |
PDB Entry: 3gqb (more details), 2.8 Å
SCOPe Domain Sequences for d3gqbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gqbd1 b.49.1.2 (D:5-78) V1 ATP synthase B subunit, domain 1 {Thermus thermophilus HB8 [TaxId: 300852]}
kkeytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvfeett
gldlattsvslved
Timeline for d3gqbd1: