Lineage for d3gqbc3 (3gqb C:113-184)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817843Superfamily b.84.5: V1 ATP synthase A subunit, bulge domain-like [310577] (1 family) (S)
    PubMed 19893485
  5. 2817844Family b.84.5.1: V1 ATP synthase A subunit, bulge domain-like [310616] (2 proteins)
  6. 2817850Protein V1 ATP synthase A subunit, bulge domain [310706] (2 species)
  7. 2817855Species Thermus thermophilus HB8 [TaxId:300852] [310935] (2 PDB entries)
  8. 2817857Domain d3gqbc3: 3gqb C:113-184 [305435]
    Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba4, d3gqbb1, d3gqbb2, d3gqbb3, d3gqbc1, d3gqbc2, d3gqbc4, d3gqbd1, d3gqbd2, d3gqbd3

Details for d3gqbc3

PDB Entry: 3gqb (more details), 2.8 Å

PDB Description: crystal structure of the a3b3 complex from v-atpase
PDB Compounds: (C:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3gqbc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqbc3 b.84.5.1 (C:113-184) V1 ATP synthase A subunit, bulge domain {Thermus thermophilus HB8 [TaxId: 300852]}
rekkwawtpmvkpgdevrggmvlgtvpefgfthkilvppdvrgrvkevkpageytveepv
vvledgtelkmy

SCOPe Domain Coordinates for d3gqbc3:

Click to download the PDB-style file with coordinates for d3gqbc3.
(The format of our PDB-style files is described here.)

Timeline for d3gqbc3: