Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.5: V1 ATP synthase A subunit, bulge domain-like [310577] (1 family) PubMed 19893485 |
Family b.84.5.1: V1 ATP synthase A subunit, bulge domain-like [310616] (2 proteins) |
Protein V1 ATP synthase A subunit, bulge domain [310706] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [310935] (2 PDB entries) |
Domain d3gqbc3: 3gqb C:113-184 [305435] Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba4, d3gqbb1, d3gqbb2, d3gqbb3, d3gqbc1, d3gqbc2, d3gqbc4, d3gqbd1, d3gqbd2, d3gqbd3 |
PDB Entry: 3gqb (more details), 2.8 Å
SCOPe Domain Sequences for d3gqbc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gqbc3 b.84.5.1 (C:113-184) V1 ATP synthase A subunit, bulge domain {Thermus thermophilus HB8 [TaxId: 300852]} rekkwawtpmvkpgdevrggmvlgtvpefgfthkilvppdvrgrvkevkpageytveepv vvledgtelkmy
Timeline for d3gqbc3: