Lineage for d3gqbc2 (3gqb C:71-112,C:185-431)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126370Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2126905Protein V1 ATP synthase A subunit, central domain [310703] (2 species)
  7. 2126910Species Thermus thermophilus HB8 [TaxId:300852] [310929] (2 PDB entries)
  8. 2126912Domain d3gqbc2: 3gqb C:71-112,C:185-431 [305434]
    Other proteins in same PDB: d3gqba1, d3gqba3, d3gqba4, d3gqbb1, d3gqbb2, d3gqbb3, d3gqbc1, d3gqbc3, d3gqbc4, d3gqbd1, d3gqbd2, d3gqbd3

Details for d3gqbc2

PDB Entry: 3gqb (more details), 2.8 Å

PDB Description: crystal structure of the a3b3 complex from v-atpase
PDB Compounds: (C:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3gqbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqbc2 c.37.1.11 (C:71-112,C:185-431) V1 ATP synthase A subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
lavelgpgmlngiydgiqrplerirektgiyitrgvvvhaldXhtwpvrrarpvqrkldp
ntpfltgmrildvlfpvamggtaaipgpfgsgksvtqqslakwsnadvvvyvgsgergne
mtdvlvefpeltdpktggplmhrtvliantsnmpvaareasiyvgvtiaeyfrdqgfsva
lmadstsrwaealreissrleempaeegyppylaarlaafyeragkvitlggeegavtiv
gavsppggdmsepvtqstlrivgafwrldaslafrrhfpainwngsyslf

SCOPe Domain Coordinates for d3gqbc2:

Click to download the PDB-style file with coordinates for d3gqbc2.
(The format of our PDB-style files is described here.)

Timeline for d3gqbc2: