SCOPe 2.06: Domain d3gqbb1: 3gqb B:5-78

Lineage for d3gqbb1 (3gqb B:5-78)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.2: N-terminal domain of A and B subunits of V1 ATP synthase [310615] (2 proteins)

6. Protein V1 ATP synthase B subunit, domain 1 [310702] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310926] (2 PDB entries)

8. Domain d3gqbb1: 3gqb B:5-78 [305430]
   Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba3, d3gqba4, d3gqbb2, d3gqbb3, d3gqbc1, d3gqbc2, d3gqbc3, d3gqbc4, d3gqbd2, d3gqbd3

Details for d3gqbb1

PDB Entry: 3gqb, 2.8 Å

PDB Description: crystal structure of the a3b3 complex from v-atpase

PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3gqbb1:

Sequence; same for both SEQRES and ATOM records:

>d3gqbb1 b.49.1.2 (B:5-78) V1 ATP synthase B subunit, domain 1 {Thermus thermophilus HB8 [TaxId: 300852]}
kkeytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvfeett
gldlattsvslved

Timeline for d3gqbb1:

• d3gqbb1 is new in SCOPe 2.06-stable
  
• d3gqbb1 appears in SCOPe 2.07
  
• d3gqbb1 appears in the current release, SCOPe 2.08