Lineage for d3gowb_ (3gow B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113738Species Thermus thermophilus HB8 [TaxId:300852] [225694] (2 PDB entries)
  8. 2113746Domain d3gowb_: 3gow B: [305421]
    automated match to d3hrxa_

Details for d3gowb_

PDB Entry: 3gow (more details), 1.85 Å

PDB Description: Crystal structure of phenylacetic acid degradation protein PaaG
PDB Compounds: (B:) Probable enoyl-CoA hydratase

SCOPe Domain Sequences for d3gowb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gowb_ c.14.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvlkerqdgvlvltlnrpeklnaitgelldalyaalkegeedrevrallltgagrafsag
qdltefgdrkpdyeahlrrynrvvealsglekplvvavngvaagagmslalwgdlrlaav
gasfttafvriglvpdsglsfllprlvglakaqellllsprlsaeealalglvhrvvpae
klmeealslakelaqgptrayaltkkllletyrlsltealaleavlqgqagqtqdheegv
rafrekrpprfqgr

SCOPe Domain Coordinates for d3gowb_:

Click to download the PDB-style file with coordinates for d3gowb_.
(The format of our PDB-style files is described here.)

Timeline for d3gowb_: