Lineage for d3ggtb_ (3ggt B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067823Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)
  8. 2067867Domain d3ggtb_: 3ggt B: [305413]
    automated match to d3u7sa_
    complexed with 017, bme

Details for d3ggtb_

PDB Entry: 3ggt (more details), 2.05 Å

PDB Description: HIV PR drug highly resistant patient's variant in complex with darunavir
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3ggtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ggtb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwqrplvvvkvggqlmealldtgaddtifeemslpgrwtpkmiggiggflnvrqyd
qvpieicghkvvstvligptplnvigrnvmtqigctlnf

SCOPe Domain Coordinates for d3ggtb_:

Click to download the PDB-style file with coordinates for d3ggtb_.
(The format of our PDB-style files is described here.)

Timeline for d3ggtb_: