Lineage for d3ggta_ (3ggt A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2391043Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2391226Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)
  8. 2391269Domain d3ggta_: 3ggt A: [305412]
    automated match to d3u7sa_
    complexed with 017, bme

Details for d3ggta_

PDB Entry: 3ggt (more details), 2.05 Å

PDB Description: HIV PR drug highly resistant patient's variant in complex with darunavir
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3ggta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ggta_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwqrplvvvkvggqlmealldtgaddtifeemslpgrwtpkmiggiggflnvrqyd
qvpieicghkvvstvligptplnvigrnvmtqigctlnf

SCOPe Domain Coordinates for d3ggta_:

Click to download the PDB-style file with coordinates for d3ggta_.
(The format of our PDB-style files is described here.)

Timeline for d3ggta_: