Lineage for d3gfca_ (3gfc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066073Protein automated matches [190346] (4 species)
    not a true protein
  7. 2066093Species Human (Homo sapiens) [TaxId:9606] [311290] (1 PDB entry)
  8. 2066094Domain d3gfca_: 3gfc A: [305410]
    automated match to d3c9ca_

Details for d3gfca_

PDB Entry: 3gfc (more details), 2.3 Å

PDB Description: crystal structure of histone-binding protein rbbp4
PDB Compounds: (A:) Histone-binding protein RBBP4

SCOPe Domain Sequences for d3gfca_:

Sequence, based on SEQRES records: (download)

>d3gfca_ b.69.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlgthtsdeqnhlvias
vqlpnddaqfdashydsekgefggfgsvsgkieieikinhegevnrarympqnpciiatk
tpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnlsghllsasddhtic
lwdisavpkegkvvdaktiftghtavvedvswhllheslfgsvaddqklmiwdtrsnnts
kpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifqv
qwsphnetilassgtdrrlnvwdlskigeeqspedaedgppellfihgghtakisdfswn
pnepwvicsvsednimqvwqmaeniyn

Sequence, based on observed residues (ATOM records): (download)

>d3gfca_ b.69.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkkntpflydlvmthalewpsltaqwlpdvtdfsihrlvlgthtqnhlviasvqlpnkie
ieikinhegevnrarympqnpciiatktpssdvlvfdytkhpskpdcnpdlrlrghqkeg
yglswnpnlsghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllhe
slfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktval
wdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigppellfihg
ghtakisdfswnpnepwvicsvsednimqvwqmaeniyn

SCOPe Domain Coordinates for d3gfca_:

Click to download the PDB-style file with coordinates for d3gfca_.
(The format of our PDB-style files is described here.)

Timeline for d3gfca_:

  • d3gfca_ is new in SCOPe 2.06-stable