Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Thioredoxin reductase [51950] (2 species) lacks the "interface" C-terminal alpha+beta domain |
Species Escherichia coli [TaxId:562] [51951] (5 PDB entries) |
Domain d1f6me1: 1f6m E:1-118,E:245-320 [30541] Other proteins in same PDB: d1f6mc_, d1f6md_, d1f6mg_, d1f6mh_ complexed with thioredoxin protein/RNA complex; complexed with 3aa, fad |
PDB Entry: 1f6m (more details), 2.95 Å
SCOPe Domain Sequences for d1f6me1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6me1 c.3.1.5 (E:1-118,E:245-320) Thioredoxin reductase {Escherichia coli [TaxId: 562]} gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasaryXh spntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsagtgcma aldaeryldgladak
Timeline for d1f6me1: