SCOP 1.59: Domain d1f6me1: 1f6m E:1-118,E:245-320

Lineage for d1f6me1 (1f6m E:1-118,E:245-320)

Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
Protein Thioredoxin reductase [51950] (2 species)
Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)
Domain d1f6me1: 1f6m E:1-118,E:245-320 [30541]
Other proteins in same PDB: d1f6mc_, d1f6md_, d1f6mg_, d1f6mh_

Details for d1f6me1

PDB Entry: 1f6m (more details), 2.95 Å

PDB Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+

SCOP Domain Sequences for d1f6me1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6me1 c.3.1.5 (E:1-118,E:245-320) Thioredoxin reductase {Escherichia coli}
gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasaryXh
spntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsagtgcma
aldaeryldgladak

SCOP Domain Coordinates for d1f6me1:

Click to download the PDB-style file with coordinates for d1f6me1.
(The format of our PDB-style files is described here.)

Timeline for d1f6me1: