Lineage for d3g8na_ (3g8n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009478Domain d3g8na_: 3g8n A: [305406]
    automated match to d3mnoa_
    complexed with gkk, gol, so4

Details for d3g8na_

PDB Entry: 3g8n (more details), 2.1 Å

PDB Description: Progesterone Receptor with bound Pyrrolidine 1
PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d3g8na_:

Sequence, based on SEQRES records: (download)

>d3g8na_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

Sequence, based on observed residues (ATOM records): (download)

>d3g8na_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdndtssslltslnqlgerqllsvvkwskslpgfrnlhi
ddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrkessfyslcltmwqip
qefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrkgvvss
sqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilagmvk
pllfhk

SCOPe Domain Coordinates for d3g8na_:

Click to download the PDB-style file with coordinates for d3g8na_.
(The format of our PDB-style files is described here.)

Timeline for d3g8na_:

  • d3g8na_ is new in SCOPe 2.06-stable