Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein P-glycoprotein (P-gp) multidrug resistance protein, head domain [310790] (2 species) Pfam PF09818 |
Species Mouse (Mus musculus) [TaxId:10090] [311047] (1 PDB entry) |
Domain d3g60a4: 3g60 A:372-626 [305401] Other proteins in same PDB: d3g60a1, d3g60a2 complexed with 0jz |
PDB Entry: 3g60 (more details), 4.4 Å
SCOPe Domain Sequences for d3g60a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g60a4 c.37.1.12 (A:372-626) P-glycoprotein (P-gp) multidrug resistance protein, head domain {Mouse (Mus musculus) [TaxId: 10090]} dsfsksghkpdniqgnlefknihfsypsrkevqilkglnlkvksgqtvalvgnsgcgkst tvqlmqrlydpldgmvsidgqdirtinvrylreiigvvsqepvlfattiaenirygredv tmdeiekavkeanaydfimklphqfdtlvgergaqlsggqkqriaiaralvrnpkillld eatsaldteseavvqaaldkaregrttiviahrlstvrnadviagfdggviveqgnhdel mrekgiyfklvmtqt
Timeline for d3g60a4: