Lineage for d3g60a3 (3g60 A:1014-1271)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870351Protein P-glycoprotein (P-gp) multidrug resistance protein, head domain [310790] (2 species)
    Pfam PF09818
  7. 2870352Species Mouse (Mus musculus) [TaxId:10090] [311047] (1 PDB entry)
  8. 2870353Domain d3g60a3: 3g60 A:1014-1271 [305400]
    Other proteins in same PDB: d3g60a1, d3g60a2
    complexed with 0jz

Details for d3g60a3

PDB Entry: 3g60 (more details), 4.4 Å

PDB Description: Structure of P-glycoprotein Reveals a Molecular Basis for Poly-Specific Drug Binding
PDB Compounds: (A:) Multidrug resistance protein 1a

SCOPe Domain Sequences for d3g60a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g60a3 c.37.1.12 (A:1014-1271) P-glycoprotein (P-gp) multidrug resistance protein, head domain {Mouse (Mus musculus) [TaxId: 10090]}
idsystqglkpnmlegnvqfsgvvfnyptrpsipvlqglslevkkgqtlalvgssgcgks
tvvqllerfydpmagsvfldgkeikqlnvqwlraqlgivsqepilfdcsiaeniaygdns
rvvsyeeivraakeanihqfidslpdkyntrvgdkgtqlsggqkqriaiaralvrqphil
lldeatsaldtesekvvqealdkaregrtciviahrlstiqnadlivviqngkvkehgth
qqllaqkgiyfsmvsvqa

SCOPe Domain Coordinates for d3g60a3:

Click to download the PDB-style file with coordinates for d3g60a3.
(The format of our PDB-style files is described here.)

Timeline for d3g60a3: