Lineage for d3fsna_ (3fsn A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399860Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2399861Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2399862Protein RPE65 [310786] (2 species)
  7. 2399863Species Cow (Bos taurus) [TaxId:9913] [311043] (8 PDB entries)
  8. 2399864Domain d3fsna_: 3fsn A: [305392]
    complexed with fe2, pg4

Details for d3fsna_

PDB Entry: 3fsn (more details), 2.14 Å

PDB Description: crystal structure of rpe65 at 2.14 angstrom resolution
PDB Compounds: (A:) Retinal pigment epithelium-specific 65 kDa protein

SCOPe Domain Sequences for d3fsna_:

Sequence, based on SEQRES records: (download)

>d3fsna_ b.69.15.1 (A:) RPE65 {Cow (Bos taurus) [TaxId: 9913]}
sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrffsy
frgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahph
iendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhs
fgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinn
kyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarkapq
pevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpqin
yqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdaleed
dgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks

Sequence, based on observed residues (ATOM records): (download)

>d3fsna_ b.69.15.1 (A:) RPE65 {Cow (Bos taurus) [TaxId: 9913]}
sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafevtdnalvniypvg
edyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfgknf
siaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkin
lfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyed
heflivdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkadtg
knlvtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglgln
hfvpdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpa
yllilnakdlsevaraeveinipvtfhglfkks

SCOPe Domain Coordinates for d3fsna_:

Click to download the PDB-style file with coordinates for d3fsna_.
(The format of our PDB-style files is described here.)

Timeline for d3fsna_: