Lineage for d3fiya_ (3fiy A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082987Species Uncultured bacterium [TaxId:77133] [188736] (6 PDB entries)
  8. 2082991Domain d3fiya_: 3fiy A: [305386]
    automated match to d1od0b_
    complexed with na

Details for d3fiya_

PDB Entry: 3fiy (more details), 1.4 Å

PDB Description: crystal structure of BglB
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3fiya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fiya_ c.1.8.4 (A:) Beta-glucosidase A {Uncultured bacterium [TaxId: 77133]}
kkfpegflwgaatssyqiegawnedgkgesiwdrftripgkikngdsgdvacdhyhryeq
dldlmrqlglktyrfsiawariqpdssrqinqrgldfyrrlveglhkrdilpmatlyhwd
lpqwvedeggwlsresasrfaeythalvaalgdqiplwvthnepmvtvwagyhmglfapg
lkdptlggrvahhlllshgqalqafralspagsqmgitlnfntiypvsaepadveaarrm
hsfqnelfleplirgqynqatlmaypnlpefiapedmqtisapidflgvnyynpmrvkss
pqppgievvqvespvtamgweiapeglydllmgitrtygklpiyitengaafddqpdqsg
qvndpqrvgyfqghigaarraladgvdlrgyyawslldnfewaegyskrfgiiyvdfetq
qrtlkqsaqwyrdvianngle

SCOPe Domain Coordinates for d3fiya_:

Click to download the PDB-style file with coordinates for d3fiya_.
(The format of our PDB-style files is described here.)

Timeline for d3fiya_:

  • d3fiya_ is new in SCOPe 2.06-stable