SCOPe 2.06: Domain d3fhsb4: 3fhs B:84-219

Lineage for d3fhsb4 (3fhs B:84-219)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)

8. Domain d3fhsb4: 3fhs B:84-219 [305381]
   Other proteins in same PDB: d3fhsa3, d3fhsb3
   automated match to d4chsb2
   complexed with gsh

Details for d3fhsb4

PDB Entry: 3fhs, 2.71 Å

PDB Description: Glutathione transferase from Glycine max at 2.7 resolution

PDB Compounds: (B:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d3fhsb4:

Sequence; same for both SEQRES and ATOM records:

>d3fhsb4 a.45.1.0 (B:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqtrfwadyvdkkiydlgrkiwtskgeekeaakkefiealklleeqlgdkt
yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfiawakrclqkesvakslpdqq
kvyefimdlrkklgie

Timeline for d3fhsb4:

• d3fhsb4 is new in SCOPe 2.06-stable
  
• d3fhsb4 appears in SCOPe 2.07
  
• d3fhsb4 appears in the current release, SCOPe 2.08