![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries) |
![]() | Domain d3fhsa4: 3fhs A:84-219 [305379] Other proteins in same PDB: d3fhsa3, d3fhsb3 automated match to d4chsb2 complexed with gsh |
PDB Entry: 3fhs (more details), 2.71 Å
SCOPe Domain Sequences for d3fhsa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fhsa4 a.45.1.0 (A:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]} llpsdpyqraqtrfwadyvdkkiydlgrkiwtskgeekeaakkefiealklleeqlgdkt yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfiawakrclqkesvakslpdqq kvyefimdlrkklgie
Timeline for d3fhsa4: