Lineage for d3fhsa4 (3fhs A:84-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714230Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)
  8. 2714239Domain d3fhsa4: 3fhs A:84-219 [305379]
    Other proteins in same PDB: d3fhsa3, d3fhsb3
    automated match to d4chsb2
    complexed with gsh

Details for d3fhsa4

PDB Entry: 3fhs (more details), 2.71 Å

PDB Description: Glutathione transferase from Glycine max at 2.7 resolution
PDB Compounds: (A:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d3fhsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhsa4 a.45.1.0 (A:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqtrfwadyvdkkiydlgrkiwtskgeekeaakkefiealklleeqlgdkt
yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfiawakrclqkesvakslpdqq
kvyefimdlrkklgie

SCOPe Domain Coordinates for d3fhsa4:

Click to download the PDB-style file with coordinates for d3fhsa4.
(The format of our PDB-style files is described here.)

Timeline for d3fhsa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fhsa3