![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.8: Choline kinase [90040] (2 proteins) Pfam PF02958 |
![]() | Protein automated matches [310849] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311202] (11 PDB entries) |
![]() | Domain d3fega_: 3feg A: [305361] automated match to d2ckoa_ complexed with adp, amp, hc7, mg, so4, unx |
PDB Entry: 3feg (more details), 1.3 Å
SCOPe Domain Sequences for d3fega_:
Sequence, based on SEQRES records: (download)
>d3fega_ d.144.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srdaerrayqwcreylggawrrvqpeelrvypvsgglsnllfrcslpdhlpsvgeeprev llrlygailqgvdslvlesvmfailaerslgpqlygvfpegrleqyipsrplktqelrep vlsaaiatkmaqfhgmempftkephwlfgtmerylkqiqdlpptglpemnllemyslkde mgnlrkllestpspvvfchndiqegnilllsepenadslmlvdfeyssynyrgfdignhf cewvydytheewpfykarptdyptqeqqlhfirhylaeakkgetlsqeeqrkleedllve vsryalashffwglwsilqasmstiefgyldyaqsrfqfyfqqkgql
>d3fega_ d.144.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srdaerrayqwcreylggawrrvqpeelrvypvnllfrcslpdhlpsvgeeprevllrly gqgvdslvlesvmfailaerslgpqlygvfpegrleqyipsrplktqelrepvlsaaiat kmaqfhgmempftkephwlfgtmerylkqiqdlpptglpemnllemyslkdemgnlrkll estpspvvfchndiqegnilllsepdslmlvdfeyssynyrgfdignhfcewvydythee wpfykarptdyptqeqqlhfirhylaeakkgetlsqeeqrkleedllvevsryalashff wglwsilqasmstiefgyldyaqsrfqfyfqqkgql
Timeline for d3fega_: