Lineage for d3fe3a_ (3fe3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (36 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1472 PDB entries)
  8. 2985053Domain d3fe3a_: 3fe3 A: [305359]
    automated match to d2wzjd_
    mutant

Details for d3fe3a_

PDB Entry: 3fe3 (more details), 1.9 Å

PDB Description: crystal structure of the kinase mark3/par-1: t211a-s215a double mutant
PDB Compounds: (A:) MAP/microtubule affinity-regulating kinase 3

SCOPe Domain Sequences for d3fe3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fe3a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qphignyrllktigkgnfakvklarhiltgrevaikiidktqlnptslqklfrevrimki
lnhpnivklfevietektlylimeyasggevfdylvahgrmkekearskfrqivsavqyc
hqkrivhrdlkaenllldadmnikiadfgfsneftvggkldafcgappyaapelfqgkky
dgpevdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdcenllkrflv
lnpikrgtleqimkdrwinagheedelkpfvepeldisdqkridimvgmgysqeeiqesl
skmkydeitatylllgr

SCOPe Domain Coordinates for d3fe3a_:

Click to download the PDB-style file with coordinates for d3fe3a_.
(The format of our PDB-style files is described here.)

Timeline for d3fe3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fe3b_