![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187449] (23 PDB entries) |
![]() | Domain d3famb_: 3fam B: [305358] automated match to d2fh9a_ |
PDB Entry: 3fam (more details), 2.2 Å
SCOPe Domain Sequences for d3famb_:
Sequence, based on SEQRES records: (download)
>d3famb_ d.144.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dgahignyqivktlgegsfgkvklayhtttgqkvalkiinkkvlaksdmqgriereisyl rllrhphiiklydvikskdeiimvieyagnelfdyivqrdkmseqearrffqqiisavey chrhkivhrdlkpenllldehlnvkiadfglsnimtdgnflktscgspnyaapevisgkl yagpevdvwscgvilyvmlcrrlpfddesipvlfknisngvytlpkflspgaaglikrml ivnplnrisiheimqddwfkvdlpeyll
>d3famb_ d.144.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dgahignyqivgkvklayhtttgqkvalkiinkkmqgriereisylrllrhphiiklydv ikskdeiimvieyagnelfdyivqrdkmseqearrffqqiisaveychrhkivhrdlkpe nllldehlnvkiadfglspnyaapevisgklyagpevdvwscgvilyvmlcrrlpfddes ipvlfknisngvytlpkflspgaaglikrmlivnplnrisiheimqddwfkvdlpeyll
Timeline for d3famb_: