![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Thioredoxin reductase [51950] (2 species) lacks the "interface" C-terminal alpha+beta domain |
![]() | Species Escherichia coli [TaxId:562] [51951] (5 PDB entries) |
![]() | Domain d1tdf_2: 1tdf 119-244 [30534] complexed with fad, nap; mutant |
PDB Entry: 1tdf (more details), 2.3 Å
SCOP Domain Sequences for d1tdf_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdf_2 c.3.1.5 (119-244) Thioredoxin reductase {Escherichia coli} lglpseeafkgrgvsacatsdgffyrnqkvavigggntaveealylsniasevhlihrrd gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag lfvaig
Timeline for d1tdf_2: