Lineage for d1tdf_2 (1tdf 119-244)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins) 
Protein Thioredoxin reductase [51950] (2 species) Species Escherichia coli [TaxId:562] [51951] (5 PDB entries) 
Domain d1tdf_2: 1tdf 119-244 [30534]
Details for d1tdf_2
PDB Entry: 1tdf (more details), 2.3 Å
PDB Description: crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
SCOP Domain Sequences for d1tdf_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdf_2 c.3.1.5 (119-244) Thioredoxin reductase {Escherichia coli}
lglpseeafkgrgvsacatsdgffyrnqkvavigggntaveealylsniasevhlihrrd
gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag
lfvaig
SCOP Domain Coordinates for d1tdf_2:
Click to download the PDB-style file with coordinates for d1tdf_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tdf_2:
- d1tdf_2 appears in SCOP 1.57
- d1tdf_2 appears in the current release, SCOPe 2.08, called d1tdfa2
View in 3D
