Lineage for d1tdfa2 (1tdf A:119-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850173Protein Thioredoxin reductase [51950] (2 species)
    lacks the "interface" C-terminal alpha+beta domain
  7. 2850174Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)
  8. 2850180Domain d1tdfa2: 1tdf A:119-244 [30534]
    complexed with fad, nap
    missing some secondary structures that made up less than one-third of the common domain

Details for d1tdfa2

PDB Entry: 1tdf (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
PDB Compounds: (A:) thioredoxin reductase

SCOPe Domain Sequences for d1tdfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdfa2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}
lglpseeafkgrgvsacatsdgffyrnqkvavigggntaveealylsniasevhlihrrd
gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag
lfvaig

SCOPe Domain Coordinates for d1tdfa2:

Click to download the PDB-style file with coordinates for d1tdfa2.
(The format of our PDB-style files is described here.)

Timeline for d1tdfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tdfa1