Lineage for d3ezcb_ (3ezc B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572528Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2572529Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2572530Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2572547Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2572574Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)
  8. 2572592Domain d3ezcb_: 3ezc B: [305337]
    automated match to d1poha_

Details for d3ezcb_

PDB Entry: 3ezc (more details)

PDB Description: phosphotransferase system, enzyme i/phosphotransferase system, hpr
PDB Compounds: (B:) protein (phosphotransferase system, hpr)

SCOPe Domain Sequences for d3ezcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezcb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d3ezcb_:

Click to download the PDB-style file with coordinates for d3ezcb_.
(The format of our PDB-style files is described here.)

Timeline for d3ezcb_: