Lineage for d1tdf_1 (1tdf 1-118,245-316)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576622Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 576818Protein Thioredoxin reductase [51950] (2 species)
    lacks the "interface" C-terminal alpha+beta domain
  7. 576819Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)
  8. 576826Domain d1tdf_1: 1tdf 1-118,245-316 [30533]

Details for d1tdf_1

PDB Entry: 1tdf (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis

SCOP Domain Sequences for d1tdf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdf_1 c.3.1.5 (1-118,245-316) Thioredoxin reductase {Escherichia coli}
gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasaryXh
spntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsagtgcma
aldaeryldgl

SCOP Domain Coordinates for d1tdf_1:

Click to download the PDB-style file with coordinates for d1tdf_1.
(The format of our PDB-style files is described here.)

Timeline for d1tdf_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tdf_2