![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins) |
![]() | Protein Thioredoxin reductase [51950] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [51951] (5 PDB entries) |
![]() | Domain d1tdf_1: 1tdf 1-118,245-316 [30533] |
PDB Entry: 1tdf (more details), 2.3 Å
SCOP Domain Sequences for d1tdf_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdf_1 c.3.1.5 (1-118,245-316) Thioredoxin reductase {Escherichia coli} gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasaryXh spntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsagtgcma aldaeryldgl
Timeline for d1tdf_1: