Lineage for d3exab1 (3exa B:2-314)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113886Family c.37.1.26: Adenosine phosphateisopentenyltransferase (IPT)-like [310655] (1 protein)
  6. 2113887Protein Adenosine phosphateisopentenyltransferase (IPT) [310818] (3 species)
  7. 2113898Species Bacillus halodurans [TaxId:86665] [311285] (1 PDB entry)
  8. 2113900Domain d3exab1: 3exa B:2-314 [305326]
    Other proteins in same PDB: d3exaa2, d3exab2, d3exac2, d3exad2
    automated match to d2qgna_

Details for d3exab1

PDB Entry: 3exa (more details), 2.3 Å

PDB Description: crystal structure of the full-length trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
PDB Compounds: (B:) tRNA delta(2)-isopentenylpyrophosphate transferase

SCOPe Domain Sequences for d3exab1:

Sequence, based on SEQRES records: (download)

>d3exab1 c.37.1.26 (B:2-314) Adenosine phosphateisopentenyltransferase (IPT) {Bacillus halodurans [TaxId: 86665]}
keklvaivgptavgktktsvmlakrlngevisgdsmqvyrgmdigtakitaeemdgvphh
lidikdpsesfsvadfqdlatpliteihergrlpflvggtglyvnavihqfnlgdirade
dyrheleafvnsygvqalhdklskidpkaaaaihpnnyrrviraleiikltgktvteqar
heeetpspynlvmigltmerdvlydrinrrvdqmveeglideakklydrgirdcqsvqai
gykemydyldgnvtleeaidtlkrnsrryakrqltwfrnkanvtwfdmtdvdfdkkimei
hnfiagkleeksk

Sequence, based on observed residues (ATOM records): (download)

>d3exab1 c.37.1.26 (B:2-314) Adenosine phosphateisopentenyltransferase (IPT) {Bacillus halodurans [TaxId: 86665]}
keklvaivgptavgktktsvmlakrlngevisgdsmqvyrgmdigtakitaeemdgvphh
lidikdpsesfsvadfqdlatpliteihergrlpflvggtglyvnavihqfnlgdirade
dyrheleafvnsygvqalhdklskidpkaaaaihpnnyrrviraleiikltgspynlvmi
gltmerdvlydrinrrvdqmveeglideakklydrgirdcqsvqaigykemydyldgnvt
leeaidtlkrnsrryakrqltwfrnkanvtwfdmtdvdfdkkimeihnfiagkleeksk

SCOPe Domain Coordinates for d3exab1:

Click to download the PDB-style file with coordinates for d3exab1.
(The format of our PDB-style files is described here.)

Timeline for d3exab1:

  • d3exab1 is new in SCOPe 2.06-stable