SCOPe 2.08: Domain d3ew0a1: 3ew0 A:33-107

Lineage for d3ew0a1 (3ew0 A:33-107)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
   Fe-S binding region and beta cap

4. Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families)
   Pfam PF09360; PubMed 17766440

5. Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)

6. Protein automated matches [310858] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries)

8. Domain d3ew0a1: 3ew0 A:33-107 [305316]
   Other proteins in same PDB: d3ew0a2, d3ew0b2
   automated match to d2qh7b_
   complexed with fes

Details for d3ew0a1

PDB Entry: 3ew0, 1.4 Å

PDB Description: the novel 2fe-2s outer mitochondrial protein mitoneet displays conformational flexibility in its n-terminal cytoplasmic tethering domain

PDB Compounds: (A:) CDGSH iron sulfur domain-containing protein 1

SCOPe Domain Sequences for d3ew0a1:

Sequence; same for both SEQRES and ATOM records:

>d3ew0a1 g.97.1.1 (A:33-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkhne
etgdnvgpliikkke

Timeline for d3ew0a1:

• d3ew0a1 first appeared in SCOPe 2.06
  
• d3ew0a1 appears in SCOPe 2.07