Lineage for d1ndab1 (1nda B:4-169,B:287-357)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67403Protein Trypanothione reductase [51947] (2 species)
  7. 67433Species Trypanosoma cruzi [TaxId:5693] [51949] (3 PDB entries)
  8. 67444Domain d1ndab1: 1nda B:4-169,B:287-357 [30527]
    Other proteins in same PDB: d1ndaa3, d1ndab3

Details for d1ndab1

PDB Entry: 1nda (more details), 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state

SCOP Domain Sequences for d1ndab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndab1 c.3.1.5 (B:4-169,B:287-357) Trypanothione reductase {Trypanosoma cruzi}
ifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkklm
vtgaqymehlresagfgwefdrttlraewkkliavkdeavlninksyeemfrdtegleff
lgwgslesknvvnvresadpasavkerletenillasgswphmpniXrsprtkdlqlqna
gvmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgtnprktd

SCOP Domain Coordinates for d1ndab1:

Click to download the PDB-style file with coordinates for d1ndab1.
(The format of our PDB-style files is described here.)

Timeline for d1ndab1: