SCOPe 2.08: Domain d3efvb_: 3efv B:

Lineage for d3efvb_ (3efv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (61 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [311283] (2 PDB entries)

8. Domain d3efvb_: 3efv B: [305260]
   automated match to d4i26c_
   complexed with nad

Details for d3efvb_

PDB Entry: 3efv, 1.9 Å

PDB Description: Crystal Structure of a Putative Succinate-Semialdehyde Dehydrogenase from Salmonella typhimurium LT2 with bound NAD

PDB Compounds: (B:) Putative succinate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3efvb_:

Sequence; same for both SEQRES and ATOM records:

>d3efvb_ c.82.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 602]}
tatqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqal
rahaeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqaviey
rplgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpag
vygwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdpfivl
ndadlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdplvee
ndlgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmtafrq
elfgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfingysa
sdarvafggvkksgfgrelshfglhefcnvqtvwknrv

Timeline for d3efvb_:

• d3efvb_ first appeared in SCOPe 2.06
  
• d3efvb_ appears in SCOPe 2.07