SCOPe 2.06: Domain d3e9sa2: 3e9s A:63-315

Lineage for d3e9sa2 (3e9s A:63-315)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (5 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries)

8. Domain d3e9sa2: 3e9s A:63-315 [305253]
   Other proteins in same PDB: d3e9sa1, d3e9sa3
   automated match to d2fe8a2
   complexed with cl, ttt, zn

Details for d3e9sa2

PDB Entry: 3e9s, 2.5 Å

PDB Description: A new class of papain-like protease/deubiquitinase inhibitors blocks SARS virus replication

PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d3e9sa2:

Sequence; same for both SEQRES and ATOM records:

>d3e9sa2 d.3.1.23 (A:63-315) automated matches {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsyttti

Timeline for d3e9sa2:

• d3e9sa2 is new in SCOPe 2.06-stable
  
• d3e9sa2 appears in SCOPe 2.07
  
• d3e9sa2 appears in the current release, SCOPe 2.08