Lineage for d3e9sa1 (3e9s A:2-62)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933511Species SARS coronavirus [TaxId:227859] [311281] (4 PDB entries)
  8. 2933513Domain d3e9sa1: 3e9s A:2-62 [305252]
    Other proteins in same PDB: d3e9sa2, d3e9sa3
    automated match to d2fe8a1
    complexed with cl, ttt, zn

Details for d3e9sa1

PDB Entry: 3e9s (more details), 2.5 Å

PDB Description: A new class of papain-like protease/deubiquitinase inhibitors blocks SARS virus replication
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d3e9sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e9sa1 d.15.1.0 (A:2-62) automated matches {SARS coronavirus [TaxId: 227859]}
evktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlps
d

SCOPe Domain Coordinates for d3e9sa1:

Click to download the PDB-style file with coordinates for d3e9sa1.
(The format of our PDB-style files is described here.)

Timeline for d3e9sa1: