![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species SARS coronavirus [TaxId:227859] [311281] (4 PDB entries) |
![]() | Domain d3e9sa1: 3e9s A:2-62 [305252] Other proteins in same PDB: d3e9sa2, d3e9sa3 automated match to d2fe8a1 complexed with cl, ttt, zn |
PDB Entry: 3e9s (more details), 2.5 Å
SCOPe Domain Sequences for d3e9sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9sa1 d.15.1.0 (A:2-62) automated matches {SARS coronavirus [TaxId: 227859]} evktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlps d
Timeline for d3e9sa1: