SCOPe 2.07: Domain d3dsrb3: 3dsr B:351-456

Lineage for d3dsrb3 (3dsr B:351-456)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [311243] (3 PDB entries)

8. Domain d3dsrb3: 3dsr B:351-456 [305237]
   Other proteins in same PDB: d3dsra1, d3dsra2, d3dsrb1, d3dsrb2
   automated match to d3j9tb3
   complexed with adp

Details for d3dsrb3

PDB Entry: 3dsr, 2.7 Å

PDB Description: ADP in transition binding site in the subunit B of the energy converter A1Ao ATP synthase

PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3dsrb3:

Sequence; same for both SEQRES and ATOM records:

>d3dsrb3 a.69.1.0 (B:351-456) automated matches {Methanosarcina mazei [TaxId: 2209]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpah

Timeline for d3dsrb3:

• d3dsrb3 first appeared in SCOPe 2.06
  
• d3dsrb3 appears in the current release, SCOPe 2.08