Class a: All alpha proteins [46456] (290 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Methanosarcina mazei [TaxId:2209] [311243] (3 PDB entries) |
Domain d3dsrb3: 3dsr B:351-456 [305237] Other proteins in same PDB: d3dsra1, d3dsra2, d3dsrb1, d3dsrb2 automated match to d3j9tb3 complexed with adp |
PDB Entry: 3dsr (more details), 2.7 Å
SCOPe Domain Sequences for d3dsrb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dsrb3 a.69.1.0 (B:351-456) automated matches {Methanosarcina mazei [TaxId: 2209]} mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpah
Timeline for d3dsrb3: