Lineage for d3dsrb2 (3dsr B:76-350)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114472Species Methanosarcina mazei [TaxId:2209] [311242] (3 PDB entries)
  8. 2114476Domain d3dsrb2: 3dsr B:76-350 [305236]
    Other proteins in same PDB: d3dsra1, d3dsra3, d3dsrb1, d3dsrb3
    automated match to d3j9tb2
    complexed with adp

Details for d3dsrb2

PDB Entry: 3dsr (more details), 2.7 Å

PDB Description: ADP in transition binding site in the subunit B of the energy converter A1Ao ATP synthase
PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3dsrb2:

Sequence, based on SEQRES records: (download)

>d3dsrb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 2209]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl

Sequence, based on observed residues (ATOM records): (download)

>d3dsrb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 2209]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarrgypgymytdlatlyeragivkgakgsvtqipilsmhpipdlsgyitegqiv
varelhrkgiyppinvlpslsrl

SCOPe Domain Coordinates for d3dsrb2:

Click to download the PDB-style file with coordinates for d3dsrb2.
(The format of our PDB-style files is described here.)

Timeline for d3dsrb2:

  • d3dsrb2 is new in SCOPe 2.06-stable