Lineage for d3dsrb1 (3dsr B:11-75)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067393Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2067394Protein automated matches [254527] (11 species)
    not a true protein
  7. 2067484Species Methanosarcina mazei [TaxId:2209] [311241] (3 PDB entries)
  8. 2067488Domain d3dsrb1: 3dsr B:11-75 [305235]
    Other proteins in same PDB: d3dsra2, d3dsra3, d3dsrb2, d3dsrb3
    automated match to d3j9tb1
    complexed with adp

Details for d3dsrb1

PDB Entry: 3dsr (more details), 2.7 Å

PDB Description: ADP in transition binding site in the subunit B of the energy converter A1Ao ATP synthase
PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3dsrb1:

Sequence, based on SEQRES records: (download)

>d3dsrb1 b.49.1.0 (B:11-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvi
ftget

Sequence, based on observed residues (ATOM records): (download)

>d3dsrb1 b.49.1.0 (B:11-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegviftget

SCOPe Domain Coordinates for d3dsrb1:

Click to download the PDB-style file with coordinates for d3dsrb1.
(The format of our PDB-style files is described here.)

Timeline for d3dsrb1: