SCOPe 2.06: Domain d3dsra1: 3dsr A:12-75

Lineage for d3dsra1 (3dsr A:12-75)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [311241] (3 PDB entries)

8. Domain d3dsra1: 3dsr A:12-75 [305232]
   Other proteins in same PDB: d3dsra2, d3dsra3, d3dsrb2, d3dsrb3
   automated match to d3j9tb1
   complexed with adp

Details for d3dsra1

PDB Entry: 3dsr, 2.7 Å

PDB Description: ADP in transition binding site in the subunit B of the energy converter A1Ao ATP synthase

PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3dsra1:

Sequence, based on SEQRES records:

>d3dsra1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvif
tget

Sequence, based on observed residues (ATOM records):

>d3dsra1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegiftget

Timeline for d3dsra1:

• d3dsra1 is new in SCOPe 2.06-stable
  
• d3dsra1 appears in SCOPe 2.07
  
• d3dsra1 appears in the current release, SCOPe 2.08