Lineage for d3drzc_ (3drz C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945784Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2945785Protein automated matches [190710] (5 species)
    not a true protein
  7. 2945786Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)
  8. 2945789Domain d3drzc_: 3drz C: [305219]
    automated match to d5bxbc_

Details for d3drzc_

PDB Entry: 3drz (more details), 1.9 Å

PDB Description: X-ray crystal structure of the N-terminal BTB domain of human KCTD5 protein
PDB Compounds: (C:) BTB/POZ domain-containing protein KCTD5

SCOPe Domain Sequences for d3drzc_:

Sequence, based on SEQRES records: (download)

>d3drzc_ d.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kwvrlnvggtyflttrqtlcrdpksflyrlcqadpdldsdkdetgaylidrdptyfgpvl
nylrhgklvinkdlaeegvleeaefynitsliklvkdkirer

Sequence, based on observed residues (ATOM records): (download)

>d3drzc_ d.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kwvrlnvggtyflttrqtlcrdpksflyrlcqsdkdetgaylidrdptyfgpvlnylrhg
klvinkdlaeegvleeaefynitsliklvkdkirer

SCOPe Domain Coordinates for d3drzc_:

Click to download the PDB-style file with coordinates for d3drzc_.
(The format of our PDB-style files is described here.)

Timeline for d3drzc_: