SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dfha2 (3dfh A:118-380)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (72 species)
    not a true protein
  7. 2088007Species Vibrionales bacterium [TaxId:391574] [311278] (1 PDB entry)
  8. 2088008Domain d3dfha2: 3dfh A:118-380 [305204]
    Other proteins in same PDB: d3dfha1, d3dfha3, d3dfhb1, d3dfhb3, d3dfhc1, d3dfhc3
    automated match to d3bsma2
    complexed with na

Details for d3dfha2

PDB Entry: 3dfh (more details), 2.2 Å

PDB Description: crystal structure of putative mandelate racemase / muconate lactonizing enzyme from Vibrionales bacterium SWAT-3
PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d3dfha2:

Sequence, based on SEQRES records: (download)

>d3dfha2 c.1.11.0 (A:118-380) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy
ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp
pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh
lcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping
ylyaseiagigveidreaaaefp

Sequence, based on observed residues (ATOM records): (download)

>d3dfha2 c.1.11.0 (A:118-380) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqlgfdqdqymdntltmfkslrek
ygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldnirsqssvslgl
gelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvriawhcppdmtpi
gaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiagigveidreaaa
efp

SCOPe Domain Coordinates for d3dfha2:

Click to download the PDB-style file with coordinates for d3dfha2.
(The format of our PDB-style files is described here.)

Timeline for d3dfha2:

  • d3dfha2 is new in SCOPe 2.06-stable