Lineage for d1aogb2 (1aog B:170-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850194Protein Trypanothione reductase, middle domain [418955] (3 species)
  7. Species Trypanosoma cruzi [TaxId:5693] [419415] (4 PDB entries)
  8. 2850215Domain d1aogb2: 1aog B:170-286 [30520]
    Other proteins in same PDB: d1aoga1, d1aoga3, d1aogb1, d1aogb3
    complexed with fad, mae

Details for d1aogb2

PDB Entry: 1aog (more details), 2.3 Å

PDB Description: trypanosoma cruzi trypanothione reductase (oxidized form)
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1aogb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aogb2 c.3.1.5 (B:170-286) Trypanothione reductase, middle domain {Trypanosoma cruzi [TaxId: 5693]}
ipgiehcissneafylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilr
gfdhtlreeltkqltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmai

SCOPe Domain Coordinates for d1aogb2:

Click to download the PDB-style file with coordinates for d1aogb2.
(The format of our PDB-style files is described here.)

Timeline for d1aogb2: