SCOPe 2.06: Domain d3d9oa1: 3d9o A:2-136

Lineage for d3d9oa1 (3d9o A:2-136)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
   SMART 00582; Pfam PF04818

6. Protein SCAF8; RNA-binding protein 16 [310741] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [310994] (4 PDB entries)

8. Domain d3d9oa1: 3d9o A:2-136 [305198]
   Other proteins in same PDB: d3d9oa2, d3d9ob2, d3d9oz_
   complexed with nh4, so4

Details for d3d9oa1

PDB Entry: 3d9o, 2 Å

PDB Description: snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii

PDB Compounds: (A:) RNA-binding protein 16

SCOPe Domain Sequences for d3d9oa1:

Sequence; same for both SEQRES and ATOM records:

>d3d9oa1 a.118.9.4 (A:2-136) SCAF8; RNA-binding protein 16 {Human (Homo sapiens) [TaxId: 9606]}
eavktfnselyslmdmkppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykvp
glyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqknn
vfkseiiqplldmaa

Timeline for d3d9oa1:

• d3d9oa1 is new in SCOPe 2.06-stable
  
• d3d9oa1 appears in SCOPe 2.07
  
• d3d9oa1 appears in the current release, SCOPe 2.08