Lineage for d3d9jb1 (3d9j B:2-136)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727132Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins)
    found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
    SMART 00582; Pfam PF04818
  6. 2727149Protein SCAF8; RNA-binding protein 16 [310741] (1 species)
  7. 2727150Species Human (Homo sapiens) [TaxId:9606] [310994] (4 PDB entries)
  8. 2727152Domain d3d9jb1: 3d9j B:2-136 [305196]
    Other proteins in same PDB: d3d9ja2, d3d9jb2
    automated match to d3d9ob_
    complexed with gol, nh4, so4

Details for d3d9jb1

PDB Entry: 3d9j (more details), 1.6 Å

PDB Description: snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
PDB Compounds: (B:) RNA-binding protein 16

SCOPe Domain Sequences for d3d9jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d9jb1 a.118.9.4 (B:2-136) SCAF8; RNA-binding protein 16 {Human (Homo sapiens) [TaxId: 9606]}
eavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykvp
glyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqknn
vfkseiiqplldmaa

SCOPe Domain Coordinates for d3d9jb1:

Click to download the PDB-style file with coordinates for d3d9jb1.
(The format of our PDB-style files is described here.)

Timeline for d3d9jb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d9jb2