![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain SMART 00582; Pfam PF04818 |
![]() | Protein SCAF8; RNA-binding protein 16 [310741] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [310994] (4 PDB entries) |
![]() | Domain d3d9jb1: 3d9j B:2-136 [305196] Other proteins in same PDB: d3d9ja2, d3d9jb2 automated match to d3d9ob_ complexed with gol, nh4, so4 |
PDB Entry: 3d9j (more details), 1.6 Å
SCOPe Domain Sequences for d3d9jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d9jb1 a.118.9.4 (B:2-136) SCAF8; RNA-binding protein 16 {Human (Homo sapiens) [TaxId: 9606]} eavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykvp glyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqknn vfkseiiqplldmaa
Timeline for d3d9jb1: